Skip to main content
Tempe Goreng (Indonesian Fried Tempeh) — Crispy, golden tempeh marinated in turmeric, garlic, and coriander

Indonesian Cuisine

Tempe Goreng (Indonesian Fried Tempeh)

Crispy, golden tempeh marinated in turmeric, garlic, and coriander

indonesiantempehfriedveganvegetarianside-dishsnackturmericcoriandergarlicplant-protein
Share

Tempe goreng is one of those dishes that appears on nearly every Indonesian table without much ceremony. It is not the centerpiece. It is the quiet constant, the thing you reach for between bites of rice and sambal, the side dish so familiar that most cooks prepare it without measuring anything at all. Sliced tempeh gets a brief soak in a paste of garlic, coriander, and turmeric, then goes straight into hot oil until the surface turns golden and just slightly crunchy. That is the whole of it.

The appeal is in the contrast. The exterior develops a thin, fragile crust from the spice paste and the frying, while the interior stays dense and nutty with that particular fermented earthiness that only tempeh has. Fresh turmeric gives the coating its warm yellow tint and a subtle bitterness that keeps the flavor from becoming one-dimensional. Coriander seeds, pounded rather than ground from a jar, release a brighter, more citrus-forward aroma that pairs naturally with the turmeric. Garlic holds the paste together and adds a savory base note.

In Java, tempe goreng turns up alongside Gado-Gado as part of a mixed plate, next to steamed rice and a bowl of Sayur Lodeh, or simply eaten on its own with sliced bird's eye chilies and a squeeze of lime. Street vendors sell it wrapped in brown paper for a few thousand rupiah. Home cooks keep a batch warm in the kitchen for anyone passing through. It belongs to the same family of everyday fried sides as Ayam Goreng Lengkuas, where a simple spice paste and hot oil do most of the work, and the result is something far more satisfying than the effort would suggest.

At a Glance

Yield

4 servings

Prep

15 minutes

Cook

15 minutes

Total

30 minutes

Difficulty

Easy

Ingredients

4 servings

Spice Paste Ingredients

For Frying

  • ¾ lbtempeh, cut into slices about 5 mm thick
  • —Neutral oil for deep frying (enough to submerge the tempeh, about 500 ml)

Method

  1. 1

    Prepare the spice paste. Place the garlic, coriander seeds, turmeric, and salt into a mortar and pound to a smooth paste. You should smell the coriander open up as the seeds crack, releasing a warm, citrus-like fragrance. If using a blender or small food processor, pulse in short bursts and scrape the sides down as needed. The paste should be fine enough that no large seed fragments remain.

  2. 2

    Thin the paste. Add the water to the mortar or blender and stir until the paste dissolves evenly into the liquid. It will turn a deep golden-yellow color.

  3. 3

    Marinate the tempeh. Arrange the tempeh slices in a single layer in a shallow dish or wide bowl. Pour the spice liquid over the slices and turn each piece gently so every surface makes contact with the paste. Let the tempeh sit for 5 minutes. The slices will absorb some of the liquid and the yellow stain on the surface should look even.

  4. 4

    Heat the oil. Pour enough oil into a deep frying pan or wok to reach a depth of about 3 cm. Heat over medium flame until the oil shimmers and a small piece of tempeh dropped in sizzles immediately and rises to the surface within a few seconds. If you have a thermometer, aim for about 170 to 180C.

  5. 5

    Fry the tempeh. Working in batches to avoid crowding, lower the marinated tempeh slices into the hot oil using a slotted spoon. Fry for about 3 minutes on the first side, until the underside turns a warm golden brown. Flip each piece and fry for another 2 to 3 minutes on the second side. The crust should look dry and lightly crisped, not pale or greasy. Listen for the frying sound to shift from a vigorous sputtering to a gentler, steadier crackle, which signals that most of the surface moisture has cooked off.

  6. 6

    Drain. Lift the fried tempeh out with a slotted spoon and place on a plate lined with paper towels. Let the pieces rest for a minute or two while the paper absorbs the excess oil.

  7. 7

    Serve warm. Arrange the tempe goreng on a plate and serve immediately while the exterior is still crisp.

Key Ingredient Benefits

Tempeh: A traditional Javanese food made by fermenting cooked soybeans with Rhizopus oligosporus mold, which binds the beans into a firm, sliceable cake. The fermentation process partially breaks down proteins and oligosaccharides, which may make tempeh easier to digest than whole soybeans for some people. Tempeh provides roughly 19 g of protein per 100 g serving, along with meaningful amounts of manganese, copper, riboflavin, and phosphorus. It is also one of the few plant foods that contains vitamin B12, though the amount varies depending on the bacterial cultures present during fermentation and may not be nutritionally reliable as a sole B12 source.

Turmeric: Fresh turmeric root contains curcumin and related curcuminoids, which are polyphenols with documented antioxidant activity in laboratory studies. In Indonesian cooking, turmeric appears in nearly every spice paste and contributes both color and a subtle earthy bitterness. The quantities used in a single recipe are small relative to supplemental doses studied in clinical trials.

Coriander seeds: The dried fruit of Coriandrum sativum, used whole or ground across Southeast Asian, South Asian, and Middle Eastern cuisines. The seeds contain linalool as their primary aromatic compound, giving them a warm, slightly citrus character that differs from the brighter, more pungent flavor of fresh coriander leaves (cilantro).

Why This Works

Pounding the spice paste rather than using pre-ground spices makes a noticeable difference. Whole coriander seeds contain volatile oils, particularly linalool, that dissipate quickly once ground. Crushing them fresh releases those oils at the moment they meet the garlic and turmeric, and the paste carries that brightness into the tempeh. The brief marination is not about penetration so much as coating. The thin layer of spice paste on the tempeh surface is what creates the golden crust during frying.

The frying temperature matters. Too low, and the tempeh absorbs oil and turns greasy. Too high, and the spice paste burns before the tempeh heats through. The 170 to 180C range lets the surface dehydrate and crisp steadily while the interior warms without drying out. Tempeh is already a cooked product, since the fermentation process involves heat, so you are not trying to cook it through from raw. You are building texture on the outside and warming the inside.

Keeping the slices thin, around 5 mm, maximizes the ratio of crisped exterior to soft interior. Thicker slices will still taste good, but the eating experience shifts toward something more bread-like and less crispy.

Substitutions & Variations

Tempeh: Use the freshest tempeh you can find. Vacuum-packed tempeh from the refrigerated section of Asian grocery stores tends to be denser and nuttier than the pasteurized shelf-stable versions. If your tempeh has dark spots on the surface, that is normal and indicates mature fermentation, not spoilage.

Fresh turmeric: If fresh turmeric root is unavailable, substitute 1/2 teaspoon of ground turmeric dissolved directly into the water. The color will be similar, but the flavor will be slightly less complex and missing the faint gingery sharpness of the fresh root.

Coriander seeds: Ground coriander can be used in a pinch. Use about 3/4 teaspoon. The flavor will be more muted since the volatile oils have already partially evaporated during processing.

Pan-frying instead of deep frying: Heat 2 tablespoons of oil in a non-stick pan over medium heat. Arrange the marinated tempeh in a single layer without overlapping and cook for 3 to 4 minutes per side. The result will be less uniformly crispy but still satisfying, and uses considerably less oil.

Sambal goreng tempeh: For a spicier, saucier variation, fry the tempeh plain, then toss it in a sambal made from shallots, garlic, chilies, tamarind paste, and palm sugar. This version, common across Java, transforms the simple fried tempeh into something closer to a condiment or relish, tangy and sweet with a lasting chili heat.

Kering tempeh: Slice the tempeh into very small matchsticks, fry until very crispy, and toss with fried peanuts, fried shallots, and a sweet-spicy glaze of kecap manis and chilies. This is a popular variant served during celebrations and Eid gatherings.

Serving Suggestions

Tempe goreng is a natural companion to steamed rice and sambal. Set a plate of it alongside Nasi Uduk with its coconut-scented rice, a few slices of cucumber, and a spoonful of chili sambal for an everyday Indonesian meal. It also belongs on a mixed rice plate next to Ayam Goreng Lengkuas and a ladle of Sayur Lodeh, where the crispy tempeh provides textural contrast to the soft vegetables in coconut broth.

For a more complete spread, serve tempe goreng as part of a Gado-Gado platter, where it joins blanched vegetables, boiled eggs, and tofu under a thick peanut dressing. In Malaysian and Singaporean contexts, fried tempeh sometimes appears alongside Nasi Lemak, tucked in next to ikan bilis and peanuts.

On its own, tempe goreng makes an excellent snack with sliced bird's eye chilies and a squeeze of fresh lime juice. Some cooks serve it with a small dish of kecap manis for dipping.

Storage & Reheating

Room temperature: Tempe goreng holds well at room temperature for several hours, which is why it appears on Indonesian buffet spreads and warung counters throughout the day. The crust will soften over time but the flavor remains good.

Refrigerator: Store leftover fried tempeh in a sealed container for up to 3 days. The texture will soften in the fridge.

Reheating: For the best texture, reheat in a dry skillet over medium heat for 2 to 3 minutes per side, or in a 180C oven for 5 to 7 minutes until the surface crisps again. Avoid the microwave if possible, as it will make the coating rubbery. A brief re-fry in a small amount of oil also works well and restores much of the original crunch.

Freezer: Fried tempeh can be frozen in a single layer on a baking sheet, then transferred to a freezer bag once solid. It keeps for up to 1 month. Reheat directly from frozen in the oven at 180C for about 10 minutes.

Cultural Notes

Tempeh, known in Indonesian as tempe, is one of Indonesia's most important contributions to world cuisine. It is the only major fermented soy product that originated outside of China and Japan. The fermentation process uses Rhizopus oligosporus mold to bind whole soybeans into a dense, sliceable cake, producing a food with much higher protein content and a different nutritional profile than tofu. Tempeh is documented in Javanese manuscripts dating back to at least the 16th century, and the city of Yogyakarta in Central Java is generally considered the cultural birthplace of the food.

For most of its history, tempeh was a Javanese village food made in small home batches. Each family wrapped freshly inoculated soybeans in banana leaves and incubated them in warm corners of the house for 24 to 48 hours until the white mold fully colonized the beans. The food remained relatively unknown outside Java until the 20th century, when Indonesian independence and the global vegetarian movement together pushed tempeh into international view. Today, tempeh is produced commercially in dozens of countries and has become one of the most widely adopted plant-based proteins in Western vegetarian cooking.

Within Indonesia, fried tempeh (tempe goreng) is the most common everyday preparation and the entry point for tempeh in nearly every Indonesian meal. It shows up as a side dish on nasi padang trays, as one of the components of gado-gado, as part of the standard nasi uduk breakfast spread, and as a casual protein at warung lunch counters across the country. Indonesian cooks generally treat properly seasoned and fried tempeh as a marker of a competent home kitchen. The marinade balance, frying temperature, and timing must all be right to produce tempeh that is crispy outside, tender inside, and properly seasoned to the center. Mass-produced commercial tempeh has spread globally, but Indonesian-made tempe from small Javanese producers is still considered the highest-quality expression of the food.

Nutrition Facts

Calories: 258kcal (13%)|Total Carbohydrates: 8g (3%)|Protein: 15g (30%)|Total Fat: 21g (27%)|Saturated Fat: 4g (20%)|Cholesterol: 0mg (0%)|Sodium: 320mg (14%)|Dietary Fiber: 3g (11%)|Total Sugars: 0g

You Might Also Like

Ratings & Comments

Ratings & Comments

Ratings

—
0 ratings
5
0
4
0
3
0
2
0
1
0

Share your thoughts on this recipe.

Sign in to rate and comment

0 Comments