Skip to main content
General Tso's Chicken (左宗棠鸡) — Double-fried crispy chicken thighs in a sweet, tangy, subtly spicy sauce with dried chilies and broccoli, the Chinese-American takeout legend

Cross-Cultural · China

General Tso's Chicken (左宗棠鸡)

Double-fried crispy chicken thighs in a sweet, tangy, subtly spicy sauce with dried chilies and broccoli, the Chinese-American takeout legend

chinesechinese-americanchickenfriedcrispytakeoutcomfort-foodspicybroccoli
Share

General Tso's chicken is named after a real person, Zuo Zongtang, a Qing dynasty military leader from Hunan province. He almost certainly never ate this dish. The version we know, crispy fried chicken in a sweet and spicy sauce, was created by Chef Peng Chang-kuei in the 1950s, first in Taiwan and later at his restaurant in New York. The original Hunanese version was reportedly drier and less sweet. American customers wanted it sweeter and saucier, and the dish evolved to meet them.

The technique is what separates a good version from a mediocre one. The chicken is marinated with Shaoxing wine, sesame oil, and white pepper, then coated in a mixture of cornstarch, flour, and toasted sesame seeds. It is deep-fried twice: the first fry at a moderate temperature cooks the chicken through, and the second fry at higher heat creates the shattering crunch that defines the dish.

The sauce is a fast reduction in a clean wok: dried chilies, garlic, Shaoxing wine, and a pre-mixed sauce of chicken stock, soy sauce, brown sugar, and rice vinegar. A cornstarch slurry thickens it into a glossy glaze. The fried chicken and blanched broccoli go in for a final toss. Serve it immediately. Crispy dishes do not wait.

At a Glance

Yield

4 servings

Prep

20 minutes

Cook

25 minutes

Total

45 minutes

Difficulty

Medium

Ingredients

4 servings
  • 1 lbboneless skinless chicken thighs, cut into 1-inch pieces (450g)
  • 1 tspShaoxing wine, for marinade
  • 1 tbspwater, for marinade
  • 1/4 tspsalt
  • 1/4 tspground white pepper
  • 1 tspsesame oil
  • 1 tsptoasted sesame seeds
  • 1 tbspall-purpose flour
  • 1/4 cupcornstarch, for coating
  • 1/3 cuplow-sodium chicken stock
  • 1 tspdark soy sauce
  • 1 tbspsoy sauce
  • 3 1/2 tbspbrown sugar
  • 1/2 tsprice wine vinegar
  • 8 ozbroccoli florets, about 3 cups (225g)
  • 4 cupspeanut or vegetable oil, for frying
  • 5-6dried red chili peppers
  • 2garlic cloves, minced
  • 2 tspShaoxing wine, for sauce
  • 2 tbspcornstarch, mixed with 2 tbsp water for slurry

Method

  1. 1

    Marinate chicken with Shaoxing wine, water, salt, white pepper, sesame oil. Mix until absorbed. Add sesame seeds, flour, cornstarch. Coat evenly.

  2. 2

    Mix sauce: chicken stock, dark soy, soy sauce, brown sugar, rice vinegar.

  3. 3

    Blanch broccoli 30-60 seconds. Drain. Ice bath optional for color.

  4. 4

    First fry: heat oil to 170°C (335°F). Fry chicken in batches for 5 minutes until light golden. Drain on rack.

  5. 5

    Second fry: fry all chicken again for 3-5 minutes until deeply golden and very crispy.

  6. 6

    Clean wok. Add 1 tbsp oil, dried chilies (5 seconds), garlic, Shaoxing wine. Add sauce, simmer. Thicken with cornstarch slurry.

  7. 7

    Add chicken and broccoli, toss until coated. Serve immediately with rice.

Key Ingredient Benefits

Chicken Thighs: Darker, more flavorful, and juicier than breast. Stays moist through double frying.

Toasted Sesame Seeds: Mixed into the coating for nutty flavor and visual texture.

Why This Works

Double frying creates a glass-like crunch. First fry cooks through, second fry drives out moisture from the coating. The sauce is concentrated and glossy, clinging to the craggy surface without penetrating.

Substitutions & Variations

Chicken breast works but dries out faster. Bake at 425°F for 20-25 min instead of frying. Use hotter dried peppers for more heat. Double the sauce for extra over rice.

Serving Suggestions

Serve over steamed rice with lo mein, egg drop soup, and spring rolls.

Storage & Reheating

Store 2 days. Reheat at 400°F 8-10 min on a wire rack. Do not freeze.

Cultural Notes

Named after Qing dynasty general Zuo Zongtang, who never ate it. Created by Chef Peng Chang-kuei in the 1950s in Taiwan, then adapted for American tastes in New York. The double-fry technique is the key to restaurant-quality crunch.

Nutrition Facts

Calories: 454kcal (23%)|Total Carbohydrates: 29.8g (11%)|Protein: 25.4g (51%)|Total Fat: 25.7g (33%)|Saturated Fat: 5.5g (28%)|Cholesterol: 94mg (31%)|Sodium: 608mg (26%)|Dietary Fiber: 2.2g (8%)|Total Sugars: 13.2g

You Might Also Like

Ratings & Comments

Ratings & Comments

Ratings

0 ratings
5
0
4
0
3
0
2
0
1
0

Share your thoughts on this recipe.

Sign in to rate and comment

0 Comments